PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr037212.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 682aa    MW: 74765.9 Da    PI: 5.554
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr037212.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS429.62.4e-1312976661374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  lv+lL++c+ea+  ++ +++++++a+l elasp+g+++ Rl ay+teAL+ r++r +++++++ +p++ +++++++ +  l+l+++vsPi+kf h+t 
  Pbr037212.1 297 LVSLLTACVEAIGLKNIAAINHFIAKLGELASPKGSAISRLSAYYTEALSLRVTRLWPHVFQINAPRKFDRRDEDSGI-ELRLLNQVSPIPKFVHFTS 393
                  6899*****************************************************************976666665.569**************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  N+ +l+a+eg++rvHiiDfdi+qGlQWp+L+q+LasR+++p ++RiTg+g+    sk+el+etg+rLa fA +l++pfef++ v++rled++l++L+v
  Pbr037212.1 394 NEILLRAFEGKDRVHIIDFDIKQGLQWPSLFQSLASRTNPPSHVRITGIGE----SKQELNETGDRLAGFAGALNLPFEFHP-VVDRLEDVRLWMLHV 486
                  ***************************************************....***************************.7************** PP

         GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                  k++E++aVn+v+qlh++l + +  +   +++L l++s++P++v v+eqea+hn++++ +r++++l+yysa+fds+ ++lp es++rikvE++ +++ei
  Pbr037212.1 487 KEHESVAVNCVFQLHKTLYDATGGA--LRDFLGLIRSTNPTIVLVAEQEAEHNESKLETRVSNSLKYYSAIFDSIGSSLPLESQARIKVEEM-FAQEI 581
                  *****************96554444..589**************************************************************.***** PP

         GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee.....sgslvlgWkdrpLvsvSaWr 374
                  +n++aceg++r erhe++ekWr+ +e+ GF+ v ++e+++ q + ll++++s+ y+v+++      ++l+l W+d+pL++vSaW+
  Pbr037212.1 582 RNIIACEGSDRLERHESFEKWRKLMEQEGFRCVGITEREMLQSQFLLKMYASENYTVKKQekdgaAEALTLSWMDQPLYTVSAWT 666
                  ***************************************************999****766667677899**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.283271641IPR005202Transcription factor GRAS
PfamPF035148.4E-129297666IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 682 aa     Download sequence    Send to blast
MLAGCSSSTL LSPRHRLRSE AAAQLQACSF QLPSMSTQRL DLPCSFPRKD TSRSQPIRPV  60
GLSVEKSIDS KAGGCSLKQS IRLPPLATSG PVTATAAFVE TGKENHDQFW GEKKRGKRFA  120
EPVDDDESFR KRAKRKRGSG DNGGDGEGGG GLSLGQLGGG NFWFQPGFHL PPTTQPPFSL  180
TCSGDEERVC YVPAEEISQP LPLSNNPWLD SIVTEITDLG KKDGGGEASR GLVGEGSAGS  240
STSSESQSLA LRVNESASEH DTGNGTRNPY VPHGGAGVVA EEEEDDESEA EHLGFELVSL  300
LTACVEAIGL KNIAAINHFI AKLGELASPK GSAISRLSAY YTEALSLRVT RLWPHVFQIN  360
APRKFDRRDE DSGIELRLLN QVSPIPKFVH FTSNEILLRA FEGKDRVHII DFDIKQGLQW  420
PSLFQSLASR TNPPSHVRIT GIGESKQELN ETGDRLAGFA GALNLPFEFH PVVDRLEDVR  480
LWMLHVKEHE SVAVNCVFQL HKTLYDATGG ALRDFLGLIR STNPTIVLVA EQEAEHNESK  540
LETRVSNSLK YYSAIFDSIG SSLPLESQAR IKVEEMFAQE IRNIIACEGS DRLERHESFE  600
KWRKLMEQEG FRCVGITERE MLQSQFLLKM YASENYTVKK QEKDGAAEAL TLSWMDQPLY  660
TVSAWTPVDA AGSSSSFSQP S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-462976655374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009344268.10.0PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN30.0SCL28_ARATH; Scarecrow-like protein 28
TrEMBLM5WU020.0M5WU02_PRUPE; Uncharacterized protein
STRINGPOPTR_0003s12240.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF91613244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.10.0GRAS family protein